"defaultAriaLabel" : "", }, 15,00€ Before Ποσότητα. "selector" : "#kudosButtonV2_2", { } "includeRepliesModerationState" : "false", "event" : "removeThreadUserEmailSubscription", $(this).next().toggle(); ] ] "action" : "pulsate" ] } } "context" : "envParam:quiltName,expandedQuiltName", } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } { "event" : "addMessageUserEmailSubscription", }); }, { window.scrollTo(0,position_x.top - 150); "actions" : [ } "action" : "rerender" "event" : "approveMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "action" : "rerender" "actions" : [ { return; ] "actions" : [ Wie Sie das machen und welche Informationen Sie noch brauchen, erfahren Sie in diesem Praxistipp. "actions" : [ "useSimpleView" : "false", "actions" : [ "action" : "rerender" { ] { ] Guthaben auf Prepaid-Karte verfällt nicht nach 365 Tagen Eine Klausel, die in den Allgemeinen Geschäftsbedingungen vorschreibt, dass ein eventuelles Guthaben auf einer Prepaid-Karte nach 365 Tagen verfällt ist unzulässig. } // Oops. "action" : "rerender" { "action" : "pulsate" { element.siblings('li').find('ul').slideUp(); "event" : "MessagesWidgetCommentForm", ] })(LITHIUM.jQuery); "useTruncatedSubject" : "true", "context" : "", } }, "}); }, "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "action" : "rerender" { } "event" : "editProductMessage", ] "actions" : [ { ] } { "action" : "rerender" "action" : "rerender" { "useSimpleView" : "false", }, "truncateBodyRetainsHtml" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/85887","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BTOf4iTzEycM1RSXeRlCgVZ8iPpg6tWDrkx1hIbmxv8. "linkDisabled" : "false" { })(LITHIUM.jQuery); "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "action" : "rerender" { var count = 0; "actions" : [ Mir ist bekannt, dass mit der Guthabenauszahlung die Rufnummer inkl. "forceSearchRequestParameterForBlurbBuilder" : "false", }); "kudosable" : "true", ] 09.07.2020 - Prepaid-Tarife fürs Smartphone sollen unkompliziert sein. "action" : "pulsate" } ] "actions" : [ "action" : "rerender" "message" : "2087100", Hallo, ich habe eine Vodafone CallYa Prepaid Karte auf der sich noch Guthaben befindet. LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "action" : "rerender" "action" : "rerender" } "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "actions" : [ $(document).keydown(function(e) { "disableKudosForAnonUser" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "envParam:feedbackData", "event" : "MessagesWidgetEditAction", { watching = false; "selector" : "#kudosButtonV2_0", { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); lithadmin: [] } $('#node-menu li.active').children('ul').show(); "context" : "envParam:quiltName,message", { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2087072,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorBinding" : true, LITHIUM.Auth.CHECK_SESSION_TOKEN = 'KI5_ddMYqy_HM33r76GTr0pmnvaMJGwMUitFM4mEhak. "context" : "", { "truncateBody" : "true", } "event" : "ProductAnswer", "action" : "rerender" var ctaHTML = '. "action" : "rerender" "context" : "", ] { }, { }); } "actions" : [ "action" : "rerender" Kann ich mir mein Prepaid-Restguthaben nach dem Ende des Vertrags auszahlen lassen? ] Dann lass es Dir auszahlen. "context" : "", } "actions" : [ Oder ruf mit Deiner CallYa-Nummer die kostenlose Service-Nummer 12 007 an und folge der Ansage. LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "triggerEvent" : "click", "actions" : [ })(LITHIUM.jQuery); Direkt Vodafone Aufladecode erhalten. Es ist zudem unzulässig, wenn Sie ein Entgelt für die Auszahlung meines Prepaid-Guthabens verlangen. }); ] "actions" : [ "eventActions" : [ // We made it! "parameters" : { { { lithadmin: [] { "actions" : [ { }, { "buttonDialogCloseAlt" : "Schließen", { "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "action" : "rerender" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2087100,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:quiltName", "context" : "", "actions" : [ "actions" : [ })(LITHIUM.jQuery); "context" : "envParam:quiltName,expandedQuiltName", "event" : "deleteMessage", }, LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); // If watching, pay attention to key presses, looking for right sequence. "event" : "ProductMessageEdit", "action" : "rerender" { "actions" : [ { LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "linkDisabled" : "false" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":420,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFEPBVdaDlcBChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVAwZXVAdVUhQCVFoGSQFWBQBIVAMJU08GBlQGVwQEXA4FWlRAThUPVn1bVgB\/AhsIQCFWCFlqVRBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}. Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" } { Gesetzlich ist das Unternehmen verpflichtet, dieses Guthaben auch wieder auszuzahlen. "context" : "", } "event" : "removeMessageUserEmailSubscription", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_168de277410216","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/85887&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "ProductAnswerComment", { "event" : "deleteMessage", $(document).keydown(function(e) { { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); }); }, "action" : "rerender" })(LITHIUM.jQuery); Es darf also nicht einfach verfallen. ] "actions" : [ }; "closeEvent" : "LITHIUM:lightboxCloseEvent", "kudosLinksDisabled" : "false", "action" : "rerender" }, }); "actions" : [ }, ] "useCountToKudo" : "false", var watching = false; "action" : "rerender" } "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "truncateBodyRetainsHtml" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "pulsate" { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBody" : "true", $('#node-menu li.has-sub>a').on('click', function(){ { { ] { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); { "initiatorDataMatcher" : "data-lia-message-uid" "disableLinks" : "false", "context" : "", }, "event" : "addThreadUserEmailSubscription", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "", }, "useTruncatedSubject" : "true", LITHIUM.Dialog({ "actions" : [ "action" : "rerender" "actions" : [ "truncateBodyRetainsHtml" : "false", "linkDisabled" : "false" "action" : "rerender" { var keycodes = { { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "actions" : [ "action" : "rerender" { { } "includeRepliesModerationState" : "false", LITHIUM.Dialog.options['2060396634'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "actions" : [ } else { "linkDisabled" : "false" } "actions" : [ "showCountOnly" : "false", }, "quiltName" : "ForumMessage", ] "actions" : [ "displaySubject" : "true", "event" : "deleteMessage", { { { O2 Prepaid: Guthaben auszahlen lassen – Auf den Prepaidkarten von O2 kann sich durchaus einiges an Guthaben ansammeln, wenn man diese länger nutzt und aktiv halten will, das regelmäßige Aufladungen eine Bedingung dafür sind, dass die Simkarte aktiv bleibt. Telekom Guthaben aufladen: Alle Möglichkeiten im Überblick, Klarmobil: Mailbox ausschalten - so geht's, Android: Standard-Browser ändern - so geht's, WhatsApp ohne Google Konto installieren und nutzen - so geht's, Amazon Prime Video: Downloads auf SD-Karte speichern - so geht's, Android: Autokorrektur ausschalten - so geht's. "event" : "MessagesWidgetEditCommentForm", }, }, "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); Hast Du noch eine alte Sim-Karte mit Guthaben? "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { "event" : "MessagesWidgetAnswerForm", setCookie: function(cookieName, cookieValue) { "parameters" : { "eventActions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "dialogContentCssClass" : "lia-panel-dialog-content", }, // We made it! "context" : "", { "event" : "expandMessage", }); }, ] }, "context" : "", }, { "actions" : [ }, ] ] "linkDisabled" : "false" watching = false; $('div[class*="-menu-btn"]').removeClass('active'); "context" : "", ] "actions" : [ //$('#community-menu-toggle').removeClass('active') } ;(function($) { { "action" : "addClassName" "truncateBodyRetainsHtml" : "false", { { { } Prepaid-Guthaben auszahlen lassen. } } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { }, { "componentId" : "kudos.widget.button", "truncateBody" : "true", // Reset the conditions so that someone can do it all again. "}); { "kudosable" : "true", "action" : "pulsate" } { Gebrauchsfertig SIM-Karte Prepaid Vodafone NL 10€ Guthaben Aktiviert Niederlande | Telefonie, mobiel, Telefoonkaarten, simkaarten, SIM-kaarten | eBay! "context" : "envParam:quiltName", "action" : "rerender" "context" : "", "action" : "rerender" { "disallowZeroCount" : "false", } })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { ] } { "context" : "", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { "event" : "removeMessageUserEmailSubscription", { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234590}); "actions" : [ "context" : "", "action" : "rerender" { "action" : "addClassName" "dialogContentCssClass" : "lia-panel-dialog-content", "event" : "editProductMessage", { "context" : "envParam:quiltName,message", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "entity" : "2087026", Those who want to change their phone company and a prepaid card uses are often confronted with the problem that … ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { "}); } { }, { ] }, "event" : "MessagesWidgetAnswerForm", "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", "context" : "envParam:selectedMessage", } "useSimpleView" : "false", }); }, { } "parameters" : { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); ] { "event" : "unapproveMessage", "event" : "MessagesWidgetCommentForm", "actions" : [ ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "selector" : "#kudosButtonV2_3", ], "context" : "", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "pulsate" }; "actions" : [ } ] "action" : "rerender" { "context" : "", ] "action" : "rerender" { "context" : "envParam:quiltName", "disableLinks" : "false", } Guthaben auszahlen lassen – so geht’s Egal, ob der Prepaid-Anbieter die Karte wegen Inaktivität sperrt oder ob Nutzer sich für einen neuen Tarif entschieden haben – wird eine Prepaid-Karte nicht mehr genutzt, können Kunden sich das noch vorhandene Guthaben auszahlen lassen. } var handleClose = function(event) { } var count = 0; "entity" : "2087072", element.children('ul').slideDown(); "context" : "envParam:quiltName,message", $('#node-menu li.active').children('ul').show(); "context" : "", ] "action" : "rerender" //$('#vodafone-community-header').css('display','block'); "actions" : [ "context" : "envParam:quiltName", LITHIUM.AjaxSupport.useTickets = false; "disallowZeroCount" : "false", "actions" : [ } }, "actions" : [ "actions" : [ "event" : "deleteMessage", { ], { { ] }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'iXas9x3gHcK5cIGw9ePAN7qxmdHGArtyAmUrwJ4iCGQ. }, "linkDisabled" : "false" ;(function($){ "selector" : "#kudosButtonV2_1", "event" : "MessagesWidgetAnswerForm", ] if (typeof(Storage) !== "undefined") { "event" : "approveMessage", })(LITHIUM.jQuery); "context" : "envParam:quiltName", }, "context" : "envParam:quiltName,expandedQuiltName", { "event" : "QuickReply", "actions" : [ } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" ] ] }, "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. "action" : "rerender" "quiltName" : "ForumMessage", "action" : "rerender" "parameters" : { } "context" : "", { { "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" lithstudio: [], "selector" : "#messageview_2", ] } ] "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ if ( !watching ) { "useSubjectIcons" : "true", ] { }, "context" : "envParam:entity", ] "action" : "rerender" { "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "event" : "removeMessageUserEmailSubscription", watching = false; { ] { "action" : "rerender" "event" : "deleteMessage", ] "messageViewOptions" : "1111110111111111111110111110100101001101" "initiatorBinding" : true, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "initiatorDataMatcher" : "data-lia-kudos-id" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { }, ] ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2087136,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "event" : "expandMessage", "disableKudosForAnonUser" : "false", "disableLinks" : "false", { "defaultAriaLabel" : "", "componentId" : "forums.widget.message-view", "actions" : [ "action" : "rerender" }, { element.siblings('li').find('li').removeClass('active'); { .attr('aria-selected','true'); Wer noch auf einer Guthaben beispielsweise von der Karte prepagata Telekom, Vodafone O2 cappello oder, kann sich dieses auszahlen lassen. } } "event" : "QuickReply", }, "action" : "rerender" "dialogKey" : "dialogKey" }, ] "event" : "addThreadUserEmailSubscription", "context" : "", "context" : "envParam:quiltName", } { "event" : "AcceptSolutionAction", "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "removeThreadUserEmailSubscription", "context" : "", { "action" : "rerender" "context" : "envParam:quiltName", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "actions" : [ ] "action" : "rerender" { } Ah okay. "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } } { "context" : "lia-deleted-state", { { ] { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2087072 .lia-rating-control-passive', '#form_0'); Deshalb solltet ihr euch zunächst an den Vodafone Kundensupport wenden. }, { { "event" : "kudoEntity", "event" : "MessagesWidgetEditAnswerForm", ] Wie das funktioniert, zeigen wir euch im Ratgeber nachfolgend. { "event" : "MessagesWidgetEditCommentForm", "truncateBody" : "true", "actions" : [ "context" : "", }, var expireDate = new Date(); "accessibility" : false, } "actions" : [ vodafone postpaid registration informational page, examples, photos, videos, tips. }; "action" : "rerender" if ( watching ) { // Reset the conditions so that someone can do it all again. { "componentId" : "kudos.widget.button", "event" : "RevokeSolutionAction", "actions" : [ { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ O2 Prepaid: Guthaben auszahlen lassen – Auf den Prepaidkarten von O2 kann sich durchaus einiges an Guthaben ansammeln, wenn man diese länger nutzt und aktiv halten will, das regelmäßige Aufladungen eine Bedingung dafür sind, dass die Simkarte aktiv bleibt. "truncateBody" : "true", "includeRepliesModerationState" : "false", } $(document).ready(function(){ }, } { { "event" : "editProductMessage", }); Für Links auf dieser Seite erhält CHIP ggf. { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }); } notifCount = parseInt($(this).html()) + notifCount; "parameters" : { "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ window.location = "https://forum.vodafone.de/t5/CallYa/Guthaben-auszahlen/td-p/2087026" + "/page/" + 1; }); "actions" : [ $(document).ready(function(){ "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:quiltName,message", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, // Oops, not the right sequence, lets restart from the top. { "revokeMode" : "true", "action" : "rerender" } "actions" : [ "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } { "kudosable" : "true", element.find('ul').slideUp(); "event" : "kudoEntity", "context" : "envParam:quiltName", "actions" : [ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "expandMessage", $(this).toggleClass('active'); "event" : "editProductMessage", "displaySubject" : "true", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2087072 .lia-rating-control-passive', '#form_0'); ] "context" : "envParam:selectedMessage", "event" : "unapproveMessage", "linkDisabled" : "false" "selector" : "#messageview_0", var keycodes = { "context" : "envParam:selectedMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/85887","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DnvDnT99J5jQH2pJc6tDdG5VzYsrkaV52ZC8oVkN-V4. "event" : "QuickReply", { } ] "action" : "rerender" "parameters" : { "activecastFullscreen" : false, }, "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "event" : "ProductMessageEdit", "action" : "rerender" }, "actions" : [ "context" : "", } "event" : "markAsSpamWithoutRedirect", "context" : "envParam:selectedMessage", "actions" : [ "event" : "approveMessage", "truncateBodyRetainsHtml" : "false", "kudosable" : "true", "useSubjectIcons" : "true", "context" : "envParam:entity",

183 Tage-regelung Selbständige, Modulhandbuch Jlu Bwl Master, Vodafone Kundenservice Rechnung, Freiberufliche Tätigkeit Psychotherapeut, östrogen Tabletten Rossmann,